PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00146g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 566aa    MW: 63988.4 Da    PI: 5.1954
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00146g00006.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like64.61.9e-20196245555
                   G2-like   5 rWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               +Wt eLH++F+++v+qL G+ +  Pk+ile+m+v+gLt+ +v+SHLQk R 
  Peaxi162Scf00146g00006.1 196 EWTVELHAKFMKVVRQL-GEGRCYPKEILEMMNVPGLTRMQVASHLQKCRN 245
                               7****************.9*****************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011013.353193IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23003.2E-68105No hitNo description
SuperFamilySSF521721.46E-59105IPR011006CheY-like superfamily
PROSITE profilePS5129410.706188248IPR017930Myb domain
SuperFamilySSF466893.23E-14192245IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.4E-20194245IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-17195246IPR006447Myb domain, plants
PfamPF002491.2E-6196243IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 566 aa     Download sequence    Send to blast
MSMLSKGKGR FDIMIMNVHS PDLQSFQLLA QAVALDIVSI CEYTLTNGSI LVLVVCDEHH  60
TVLVRKVLDI GAYLYLKKPL HEEFVKYMWQ FVLRERLKKE KEREERTGEM NIIDDGAFIR  120
NNIVRDEQVG LKIIPNNNED DHDERDNRTE VGNNINVVSK GKYKVRRSKR GRKITTTEVE  180
PDSQSTGGPR RKVCTEWTVE LHAKFMKVVR QLGEGRCYPK EILEMMNVPG LTRMQVASHL  240
QKCRNNNWRI PEARKVHHPN GRRFSVGSQQ RVSQRKFGSM PRLQTNFVEQ QHQQPNQDQS  300
QRVPLPPEFV FPPPNNNNIF VRGESSTEQQ VYRPQLVLVE PHYVNIGNSV SNPLLSHINA  360
GGLQQHAGGP YGIVDLGQGG QVIDESIVYT PGLGDHVHND CNMNATMGHG TYSESAMISD  420
TNENETIDTF LVAAENANFQ QLYGEHNLSD PSMNIVASHA SDSETGSDER TDCDEYFDFN  480
DVDYLFQNLG PPDNDLPKEQ CGNEFDQVYS DDQVAPTPSI QFPRTTYFPG EQAGSEFDQV  540
YSDDQVAPTP SVQFPAGTAS FPDESR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016461121.11e-156PREDICTED: two-component response regulator ORR21-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8132384
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.13e-25response regulator 2